SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017623 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017623
Domain Number 1 Region: 618-823
Classification Level Classification E-value
Superfamily Fibronectin type III 4.74e-34
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 2 Region: 1046-1138
Classification Level Classification E-value
Superfamily Immunoglobulin 2.62e-25
Family I set domains 0.0086
Further Details:      
 
Domain Number 3 Region: 929-1017
Classification Level Classification E-value
Superfamily Fibronectin type III 6.06e-22
Family Fibronectin type III 0.00097
Further Details:      
 
Domain Number 4 Region: 534-626
Classification Level Classification E-value
Superfamily Immunoglobulin 1.93e-19
Family I set domains 0.00096
Further Details:      
 
Domain Number 5 Region: 344-430
Classification Level Classification E-value
Superfamily Immunoglobulin 2.56e-18
Family I set domains 0.0000115
Further Details:      
 
Domain Number 6 Region: 60-162
Classification Level Classification E-value
Superfamily Immunoglobulin 2.13e-17
Family I set domains 0.00000188
Further Details:      
 
Domain Number 7 Region: 262-344
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000296
Family I set domains 0.00044
Further Details:      
 
Domain Number 8 Region: 435-526
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000211
Family I set domains 0.015
Further Details:      
 
Domain Number 9 Region: 847-935
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000323
Family I set domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017623   Gene: ENSGGOG00000010147   Transcript: ENSGGOT00000028269
Sequence length 1173
Comment pep:known_by_projection chromosome:gorGor3.1:12:100898630:100989623:1 gene:ENSGGOG00000010147 transcript:ENSGGOT00000028269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVEPPPGEEQAKQNANSQLSILF
IEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHS
RVYTFEMQIIKAKENFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGE
GQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKR
LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF
EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE
LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG
QSSAKLSVDLKPLKILTPLTDQTVNLGKEIYLKCEISENIPGKWTKNGLPVQESDRLKVV
HKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG
NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN
LKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK
KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP
PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAE
DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIR
IPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRK
AERSHSGKYDLQVKVDKFVETALIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGN
AAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMT
KESAVIAKDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITW
MKNKVVIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIY
QGVNTPGQPVFLEGQQQVGSPSADSSCKAYLQT
Download sequence
Identical sequences G3RPA3
XP_004053814.1.27298 ENSGGOP00000009912 ENSGGOP00000017623 ENSGGOP00000009912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]