SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017827 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017827
Domain Number 1 Region: 13-170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.53e-44
Family Dual specificity phosphatase-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017827   Gene: ENSGGOG00000024300   Transcript: ENSGGOT00000023492
Sequence length 198
Comment pep:known_by_projection chromosome:gorGor3.1:5:46613915:46617571:-1 gene:ENSGGOG00000024300 transcript:ENSGGOT00000023492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNAT
IEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSAT
LCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGI
VPDVYEKESRHLMPYWGI
Download sequence
Identical sequences A0A2J8RCF2 A0A2K5HAM9 A0A2K5PKE5 F7I8K4 H0XLE6 H2QCS1 O95147 Q6FI36
ENSP00000477653 ENSP00000478406 ENSP00000478595 ENSP00000484091 9598.ENSPTRP00000015436 9606.ENSP00000292964 ENSOGAP00000016936 NP_008957.1.87134 NP_008957.1.92137 XP_001173350.1.37143 XP_003278440.1.23891 XP_003278441.1.23891 XP_003278442.1.23891 XP_003733002.1.60252 XP_003795665.1.62490 XP_004041906.1.27298 XP_004041909.1.27298 XP_005257034.1.92137 XP_008566288.1.73410 XP_008969470.1.60992 XP_008969471.1.60992 XP_008995263.1.60252 XP_011522536.1.92137 XP_011809011.1.43180 XP_011809012.1.43180 XP_011809013.1.43180 XP_012300965.1.9421 XP_012300966.1.9421 XP_012359076.1.23891 XP_012359077.1.23891 XP_012504095.1.63892 XP_016787439.1.37143 XP_017395372.1.71028 XP_017395373.1.71028 ENSP00000377910 ENSPTRP00000015436 ENSOGAP00000016936 ENSGGOP00000017827 ENSNLEP00000003296 ENSPTRP00000015436 ENSCJAP00000028129 ENSCJAP00000046512 gi|5902002|ref|NP_008957.1| HR2889 NYSGXRC-8662a ENSNLEP00000003296 ENSP00000377910 ENSP00000377912 ENSP00000466299 ENSGGOP00000017827 ENSCJAP00000028129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]