SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017866 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017866
Domain Number 1 Region: 527-775
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.04e-78
Family Eukaryotic proteases 0.0000652
Further Details:      
 
Domain Number 2 Region: 193-314
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.46e-36
Family Frizzled cysteine-rich domain 0.00015
Further Details:      
 
Domain Number 3 Region: 318-356
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 394-438
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 82-120
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 9-46
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 123-164
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 44-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000118
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 360-392
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000759
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 10 Region: 451-530
Classification Level Classification E-value
Superfamily SRCR-like 0.0000183
Family Hepsin, N-terminal domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017866   Gene: ENSGGOG00000011143   Transcript: ENSGGOT00000025844
Sequence length 786
Comment pep:known_by_projection chromosome:gorGor3.1:4:48031879:48139704:-1 gene:ENSGGOG00000011143 transcript:ENSGGOT00000025844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEHGWEMLCGTGENFLCASGICIPRKLQCNGYNDCDDWSDEAHCNCSENLFHCHTGKCLN
YSLVCDGYDDCGDLSDEQNCDCNPTTEHRCGDGRCIAMEWVCDGDHDCVDKSDEVNCSCH
SQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTSCQEGDQRCLYNPCLDSCGGS
SLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQT
NCYKYLMFFSCTILVPKCDVNTGQRIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQF
PEENSDNRTCLMPDEYVEECSPSHFKCRSGRCVLASRRCDGQADCDDDSDEENCGCKERD
LWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADC
SDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADGWQEMLSQLACKQMGLGEPSVTKL
IQEQEKEPRWLTLHSNWESLNGTTLHEFLVNGQSCESRSKISLLCTKQDCGRRPAARMNK
RILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGI
NNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDINETGYVRPVCLPNPEQWL
QPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDVKTITTRMICAGYESGTVDS
CMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIKRQIYIQTFL
LNKSQD
Download sequence
Identical sequences ENSGGOP00000017866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]