SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017963 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017963
Domain Number 1 Region: 134-237
Classification Level Classification E-value
Superfamily Immunoglobulin 2.93e-19
Family C2 set domains 0.053
Further Details:      
 
Domain Number 2 Region: 233-325
Classification Level Classification E-value
Superfamily Immunoglobulin 9.54e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 40-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000657
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017963   Gene: ENSGGOG00000005133   Transcript: ENSGGOT00000027029
Sequence length 402
Comment pep:known_by_projection chromosome:gorGor3.1:1:138180744:138209927:1 gene:ENSGGOG00000005133 transcript:ENSGGOT00000027029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YWQEQDLELGTLAPLDEAISSTVWSSPDMLASQDSQPWTSDETVVAGGTVVLKCQVKDHE
DSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMP
VRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEP
TRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAM
IRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGT
YGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYHAIIGGIVAFIVFLLLIMLIFLGHYLI
RHKGTYLTHEAKGSDDAPDADTAIINAEGGQSGGDDKKEYFI
Download sequence
Identical sequences ENSGGOP00000005029 ENSGGOP00000017963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]