SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017966 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017966
Domain Number 1 Region: 3-485
Classification Level Classification E-value
Superfamily Sema domain 2.35e-169
Family Sema domain 0.000000000105
Further Details:      
 
Domain Number 2 Region: 481-535
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000209
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 554-635
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000144
Family V set domains (antibody variable domain-like) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017966   Gene: ENSGGOG00000025533   Transcript: ENSGGOT00000033553
Sequence length 738
Comment pep:known_by_projection chromosome:gorGor3.1:7:80515887:80638741:-1 gene:ENSGGOG00000025533 transcript:ENSGGOT00000033553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLNLNRTSIFHSPFGFLDLHTMLLDEYQERLFVGGRDLVYSLSLERISDGYKEIHWPST
ALKMEECIMKGKDAGECANYVRVLHHYNRTHLLTCGTGAFDPVCAFIRVGYHLEDPLFHL
ESPRSERGRGRCPFDPSSSFISTLIGSELFAGLYSDYWSRDAAIFRSMGRLAHIRTEHDD
ERLLKEPKFVGSYMIPDNEDRDDNKVYFFFTEKALEAENNAHAIYTRVGRLCVNDVGGQR
ILVNKWSTFLKARLVCSVPGMNGIDTYFDELEDVFLLPTRDHKNPVIFGLFNTTSNIFRG
HAICVYHMSSIRAAFNGPYAHKEGPEYHWSVYEGKVPYPRPGSCASKVNGGRYGTTKDYP
DDAIRFARSHPLMYQAIKPAHKKPILVKTDGKYNLKQIAVDRVEAEDGQYDVLFIGTDNG
IVLKVITIYNQEMESMEEVILEELQIFKEDPQCWIIANLSELNQQLYIGSASAVAQVRFH
HCDMYGSACADCCLARDPYCAWDGISCSRYYPTGTHAKRRFRRQDVRHGNAAQQCFGQQF
VGDALDKTEEHLAYGIENNSTLLECTPRSLQAKVIWFVQKGRETRKEEVKTDDRVVKMDL
GLLFLRLHKSDAGTYFCQTVEHSFVHTVRKITLEVVEEEKVEDMFNKDDEEDRHHRMPCP
AQSSISQGAKPWYKEFLQLIGYSNFQRVEEYCEKVWCPDRKRKKLKMSPSKWKYANPQEK
RLRSKPEHYRLPRHTLDS
Download sequence
Identical sequences ENSGGOP00000017966 ENSGGOP00000017966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]