SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017973 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017973
Domain Number 1 Region: 643-1218
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 7.65e-177
Family Myeloperoxidase-like 0.00000000253
Further Details:      
 
Domain Number 2 Region: 2-159
Classification Level Classification E-value
Superfamily L domain-like 1.19e-32
Family Ngr ectodomain-like 0.0013
Further Details:      
 
Domain Number 3 Region: 154-244
Classification Level Classification E-value
Superfamily Immunoglobulin 5.94e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 433-520
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-22
Family I set domains 0.0093
Further Details:      
 
Domain Number 5 Region: 250-343
Classification Level Classification E-value
Superfamily Immunoglobulin 4.05e-22
Family I set domains 0.0081
Further Details:      
 
Domain Number 6 Region: 333-427
Classification Level Classification E-value
Superfamily Immunoglobulin 3.72e-21
Family I set domains 0.016
Further Details:      
 
Domain Number 7 Region: 1314-1373
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000816
Family VWC domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017973   Gene: ENSGGOG00000014572   Transcript: ENSGGOT00000032656
Sequence length 1384
Comment pep:known_by_projection chromosome:gorGor3.1:8:49106714:49385055:-1 gene:ENSGGOG00000014572 transcript:ENSGGOT00000032656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLNNNHIRKISRNAFEGLENLLYLYLYKNEIHALDKQTFKGLISLEHLYIHFNQLEMLQP
ETFGDLLRLERLFLHNNKLSKIPAGSFSNLDSLKRLRLDSNALVCDCDLMWLGELLQGFA
QHGHTQAAATCEYPMRLHGRAVASVTAEEFNCQSPRITFEPQDVEVPSGNTVYFTCRAEG
NPKPEIIWIHNNHSLDLEDNTRLNVFDDGTLMIRNTRESDQGVYQCMARNSAGEAKTQSA
MLRYSSLPAKPSFVIQPQDTEVLIGTSTTLECMATGHPQPHITWTRDNGLELDGSRHVAT
SSGLYLQNITQWDHGRFTCHANNSHGTVEAAANIIVQVPPQFTVTPKDQVVLEEHAVEWL
CEADGNPPPVIVWTKTGGQLPVEGQHTVLSSGTLRIDRAAQHDQGQYECQAVSSLGVKKV
SVQLTVKPKVLAVFTQLPQDTSVEVGKNINISCHAQGEPQPIITWNKEGVQITESGKFHV
DDEGTLTIYDAGFPDQGRYECVARNSFGLAVTNMFLTVTAIQGRQAGDDFVESSILDAVQ
RVDSAINSTRRHLFSQKPHTSSDLLAQFHYPRDPLIVEMARSGEIFEHTLQLIRERVKQG
LTVDLEGKEFRYNDLVSPRSLSLIANLSGCTARRPLPNCSDRCFHAKYRAHDGTCNNLQQ
PTWGAALTAFARLLQPAYQDGICAPRGXXXXXXXXXXXXXXXXXXTVWARAAAVTPDHSY
TRMLMHWGWFLEHDLDHTVPALSTARFSDGRPCSSVCTKDPPCFPMNTRHADPRGTHAPC
KLFARSSPACASGRPSATVDSVYAREQINQQTAYIDGSNVYGSSERESQALRDPSVPRGL
LRTGFPWPPSGKPLLPFSTGPPTECARQEQDSPCFLAGDHRANEHLALTAMHTLWFREHN
RVATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPKVLGDPGTRMLRGYRGYNPN
VNAGIINSFATAAFRFGHTLINPIFYRLNATLGEISEGHLPFHKALFSPSRIIKEGGIDP
VLRGLFGVAAKWRAPSYLLSPELTQRLFSATYSAAVDSAATIIQRGRDHGIPPYADFRVF
CNLTSVKNYEDLQNEIKDSEIRQKLRKLYGSPGDIDLWPALMVEDLIPGTRVGPTLMCLF
VTQFQRLRDGDRFWYENPGVFTPAQLTQLKQASLGRVLCDNGDSIQQVQADVFVKAEYPQ
DYLSCSEIPKVDLRVWQDCCADCRSRGQFRAATQESQKKRSAQYSYPDDKDMELSHLRSR
QQDKIYVGEDARNVTVLAKTKFSQDFSAFAAEIQETITALREQINKLEARLRQAGCTDVK
GVPRKAEERWMKEDCTHCICESGQVTCVVEICPPAPCPSPELVKGTCCPVCRDRGMPSDS
PEKR
Download sequence
Identical sequences ENSGGOP00000014207 ENSGGOP00000017973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]