SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018007 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018007
Domain Number 1 Region: 35-140
Classification Level Classification E-value
Superfamily Immunoglobulin 9.23e-23
Family V set domains (antibody variable domain-like) 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018007   Gene: ENSGGOG00000001981   Transcript: ENSGGOT00000023568
Sequence length 244
Comment pep:known_by_projection chromosome:gorGor3.1:19:38931356:38939301:-1 gene:ENSGGOG00000001981 transcript:ENSGGOT00000023568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPPSAAPHGGHRPWQGLLITASLLTFWDPPTTVQFTIEALPSSAAEGKDVILLACNISE
TIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSY
TLRTINASYDSDQATGQLHVHQNNVPGLPAGAVAGIVTGVLVGVALVAALVCFLLLSRTG
RASIQRDLREQPPPASTPGHGPSHRSTFSAPLPSPRTATPIYEELLYSDANIYCQIDHKA
DVVS
Download sequence
Identical sequences G3RQD4
ENSGGOP00000018007 XP_004060850.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]