SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018107 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018107
Domain Number 1 Region: 17-131
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-28
Family Kringle modules 0.00085
Further Details:      
 
Domain Number 2 Region: 218-324
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-20
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018107   Gene: ENSGGOG00000005129   Transcript: ENSGGOT00000026082
Sequence length 462
Comment pep:known_by_projection chromosome:gorGor3.1:16:3141457:3145714:1 gene:ENSGGOG00000005129 transcript:ENSGGOT00000026082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPC
LFWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCH
MPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDL
ARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYG
PDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPSGPLRLG
TAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGANVSCSPRPRA
PPAAIGARVFSTVTAVSVVLLVPLGVVCALXXXSCLLAPGKGPPALGPSRGPRRSWAVWY
RQPRGVALPCSPGDPQAEGSAAGYRPLSASSQSSLRSLISAL
Download sequence
Identical sequences ENSGGOP00000005026 ENSGGOP00000018107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]