SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018173 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018173
Domain Number 1 Region: 64-242
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.6e-81
Family MHC antigen-recognition domain 0.00000000833
Further Details:      
 
Domain Number 2 Region: 246-338
Classification Level Classification E-value
Superfamily Immunoglobulin 2.39e-30
Family C1 set domains (antibody constant domain-like) 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018173   Gene: ENSGGOG00000012802   Transcript: ENSGGOT00000023546
Sequence length 398
Comment pep:known_by_projection chromosome:gorGor3.1:6:31437749:31440797:1 gene:ENSGGOG00000012802 transcript:ENSGGOT00000023546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEPSFYSSRRPWPLPRPGRVSAGSGWKWPLPGVERGRPGGGEGLGEPRREEDRADLSPSS
PPGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNEAASPRMVPRAPWMEQEGSE
YWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCDLGPDGRFLRGYEQFAY
DGKDYLTLNEDLRSWTAVDTAAQISERKSNDACEAEHQRAYLEDTCVEWLRKYLEKGKET
LLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVDTRPAGD
GTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWKPASQPTIPIVGIIAGLVLLGSVV
SGAVVAAVIWRKKSSGGKGRSYSKAEWSDSAGSESHSL
Download sequence
Identical sequences ENSGGOP00000026032 ENSGGOP00000018173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]