SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018204 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018204
Domain Number 1 Region: 22-117
Classification Level Classification E-value
Superfamily Immunoglobulin 2.42e-22
Family C1 set domains (antibody constant domain-like) 0.00000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018204   Gene: ENSGGOG00000001602   Transcript: ENSGGOT00000030780
Sequence length 122
Comment pep:novel chromosome:gorGor3.1:15:23464167:23469043:1 gene:ENSGGOG00000001602 transcript:ENSGGOT00000030780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWGKSYI
LL
Download sequence
Identical sequences XP_005254606.1.92137 XP_008962050.1.60992 XP_018866136.1.27298 ENSGGOP00000018204 ENSP00000437604 ENSGGOP00000018204 ENSP00000453023 ENSP00000437604 ENSP00000453023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]