SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018251 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018251
Domain Number 1 Region: 198-288
Classification Level Classification E-value
Superfamily PKD domain 0.00000000471
Family PKD domain 0.0084
Further Details:      
 
Domain Number 2 Region: 298-335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018251   Gene: ENSGGOG00000024974   Transcript: ENSGGOT00000023755
Sequence length 490
Comment pep:known_by_projection chromosome:gorGor3.1:6:150804512:150849832:-1 gene:ENSGGOG00000024974 transcript:ENSGGOT00000023755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XQRRLPPRHGALRGLLLLCLWLPSGRAALPPAAPLSELHAQLSGVEQLLEEFRRQLQQER
PQEELELELRAGVGPQEDCPGPGGGGYSAMPDAIIRTKDSLAAGASFLRAPAAVRGWRQC
VAACCSEPRCSVAVVELPRRPAPPAAVLGCYLFNCTARGRNVCKFALHSGYSSYSLSRAP
DGAALATARASPRQEKDAPPLSKAGQDVVLHLPTDGVVLDGRESTDDHAIVQYEWALLQG
DPSVDMKVPQSGTLKLSHLQEGTYTFQLTVTDTAGQRSSDNVSVTVLRAAYSTGGCLHTC
SRYHFFCDDGCCIDITLACDGVQQCPDGSDEDFCQNLGLDRKMVTHTAASPALPRTTGPS
EDAGGDSLVEKSQKATTPNKPPALSNTEKRNHSAFWEPESQIIPVMPDSSSSGKNRKEES
YIFESKGDGGGGEHPAPETGAVLPLALGLAITALLLLMVACRLRLVKQKLKKARPITSEE
SDYLINGMYL
Download sequence
Identical sequences ENSGGOP00000018251 ENSGGOP00000018251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]