SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018277 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018277
Domain Number 1 Region: 27-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000282
Family V set domains (antibody variable domain-like) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018277   Gene: ENSGGOG00000026624   Transcript: ENSGGOT00000027876
Sequence length 128
Comment pep:known_by_projection chromosome:gorGor3.1:7:39081361:39081873:-1 gene:ENSGGOG00000026624 transcript:ENSGGOT00000027876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLALALLLAFLPPASQKSSNLEGRTKSVTRPPGSSAVITCDLPVENAAYIHWYLHQEGK
APQRLLYYDSYNSRVVLESGISREKYHAYASTGKSLKFIVENLIEHDSGSITVPPGIGTV
IQTCATPH
Download sequence
Identical sequences ENSGGOP00000018277 ENSGGOP00000018277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]