SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018290 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018290
Domain Number 1 Region: 32-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000829
Family V set domains (antibody variable domain-like) 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018290   Gene: ENSGGOG00000012864   Transcript: ENSGGOT00000025609
Sequence length 250
Comment pep:known_by_projection chromosome:gorGor3.1:1:119592229:119655581:-1 gene:ENSGGOG00000012864 transcript:ENSGGOT00000025609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGSDAGRALGVLGVVCLLHCFGFISCFSQQIYGVVYGSVTFHVPSNVPLKEVLWKKQK
DKVAELENSEFRAFSSFKNRVYLDSVSGSLTIYNLTSSDEDEYEMESPNITETMKFFLYV
LESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTNIYFKMEND
LSQKIQCTVSNPLFNTTSSIILATCIPSSGHSRHRYALIPVPLAVITTCIVLYMNGILKC
DRKPDRTNSN
Download sequence
Identical sequences G3RR66
ENSGGOP00000012546 ENSGGOP00000018290 XP_004026463.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]