SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018299 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018299
Domain Number 1 Region: 346-445
Classification Level Classification E-value
Superfamily Immunoglobulin 8.27e-28
Family C1 set domains (antibody constant domain-like) 0.00039
Further Details:      
 
Domain Number 2 Region: 242-339
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-23
Family C1 set domains (antibody constant domain-like) 0.0019
Further Details:      
 
Domain Number 3 Region: 23-116
Classification Level Classification E-value
Superfamily Immunoglobulin 5.01e-22
Family C1 set domains (antibody constant domain-like) 0.00000441
Further Details:      
 
Domain Number 4 Region: 127-226
Classification Level Classification E-value
Superfamily Immunoglobulin 2.08e-21
Family C1 set domains (antibody constant domain-like) 0.0023
Further Details:      
 
Domain Number 5 Region: 1-32
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000739
Family V set domains (antibody variable domain-like) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018299   Gene: ENSGGOG00000024634   Transcript: ENSGGOT00000027097
Sequence length 492
Comment pep:known_by_projection chromosome:gorGor3.1:14:87979848:87990966:-1 gene:ENSGGOG00000024634 transcript:ENSGGOT00000027097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YYYYMDVWGKGTTVTVSSGSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITFSW
KYKNNSDISSTQGFPSVLRGGKYAATSQVLLPSKEVMQGTDEHVVCKVQHPNGNKEKNVP
LPVIAELPPKVSVFVPPRDGFFGNPRKSKLICQATGFSPRQIQVSWLREGKQVGSGVTTD
QVQAEAKESGPTTYKVTSTLTIKESDWLSQSMFTCRVDHRGLTFQQNASSMCSPDQDTAI
RVFAIPPSFASIFLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNTTF
SAVGEASICEDDWNSGERFTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLN
LRELATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPRAPGRYFAHSILTVSE
EEWNTGETYTCVVAHEALPNRVTERTVDKSTEGEVSADEEGFENLWATASTFIVLFLLSL
FYSTTVTLFKVK
Download sequence
Identical sequences ENSGGOP00000018299 ENSGGOP00000018299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]