SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018322 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018322
Domain Number 1 Region: 828-1019
Classification Level Classification E-value
Superfamily Fibronectin type III 3.16e-31
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 2 Region: 627-824
Classification Level Classification E-value
Superfamily Fibronectin type III 8.6e-29
Family Fibronectin type III 0.0000632
Further Details:      
 
Domain Number 3 Region: 254-343
Classification Level Classification E-value
Superfamily Immunoglobulin 1.85e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 428-525
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 515-610
Classification Level Classification E-value
Superfamily Immunoglobulin 2.49e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 6 Region: 336-431
Classification Level Classification E-value
Superfamily Immunoglobulin 4.46e-17
Family I set domains 0.0042
Further Details:      
 
Domain Number 7 Region: 39-143
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000479
Family I set domains 0.0094
Further Details:      
 
Domain Number 8 Region: 146-233
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000109
Family I set domains 0.021
Further Details:      
 
Domain Number 9 Region: 1106-1181
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000204
Family Fibronectin type III 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018322   Gene: ENSGGOG00000014728   Transcript: ENSGGOT00000028552
Sequence length 1327
Comment pep:known_by_projection chromosome:gorGor3.1:1:184857389:185055354:1 gene:ENSGGOG00000014728 transcript:ENSGGOT00000028552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPSIQNELTQPPTITKQSVKDHIVDPRDNIL
IECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFA
RNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVA
ERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKA
LRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLAN
AFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHV
YENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVAKRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQ
DLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNSPITD
YVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVT
VWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYPRAAPTEVKVRVMNST
AISLQWNRVYSDTVQGQLREYRAYYWRESSLLKNLWVSQKRQQASFPGDRLRGVVSRLFP
YSNYKLEMVVVNGRGDGPRSETKEFTTPEGEVPSAPRRFRVRQPNLETINLEWDHPEHPN
GIMIGYTLKYVAFNGTKVGKQIVENFSPNQTKFTVQRTDPVSRYRFTLSARTQVGSGEAV
TEESPAPPNEATPTAAPPTLPPTTVGATGAVSSTDATAIAATTEATTVPIIPTVAPESPP
TTTSGTKIHESAPDEQSIWNVTVLPNSKWANITWKHNFGPGTDFVVEYIDSNHTKKTVPV
KAQAQPIQLTDLYPGMTYTLRVYSRDNEGISSTVITFMTSTAYTNNQADIATQGWFIGLM
CAIALLVLILLIVCFIKRSRGGKYPDQVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQG
SQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEGNESSEATSPV
NAIYSLA
Download sequence
Identical sequences ENSGGOP00000018322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]