SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018361 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018361
Domain Number 1 Region: 626-825
Classification Level Classification E-value
Superfamily Fibronectin type III 4.29e-33
Family Fibronectin type III 0.00011
Further Details:      
 
Domain Number 2 Region: 828-1022
Classification Level Classification E-value
Superfamily Fibronectin type III 2.45e-32
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 3 Region: 256-353
Classification Level Classification E-value
Superfamily Immunoglobulin 9.18e-18
Family I set domains 0.0078
Further Details:      
 
Domain Number 4 Region: 340-435
Classification Level Classification E-value
Superfamily Immunoglobulin 2.01e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 442-528
Classification Level Classification E-value
Superfamily Immunoglobulin 3.07e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 535-650
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000011
Family I set domains 0.02
Further Details:      
 
Domain Number 7 Region: 31-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000899
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 131-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000105
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018361   Gene: ENSGGOG00000008679   Transcript: ENSGGOT00000025499
Sequence length 1225
Comment pep:known_by_projection chromosome:gorGor3.1:3:306515:398511:1 gene:ENSGGOG00000008679 transcript:ENSGGOT00000025499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLLLGRGLIVSLIFFLLKFSKAIEIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAK
GNPEPTFSWTKDGNPFYFTDHRIITSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMS
EEIEFIVPSVPKFPKEKIDPLEVEEGDPVVLPCNPPKGLPPLHIYWMNIELEHIEQDERV
YMSQKGDLYFANVEEKDSRNDYCCFAAFPRLRTIVQKMPMKLTVNSLKHANDSSSSTEIG
SKANSIKQRKPKLLLPPTESGSESSITILKGEILLLECFAEGLPTPQVDWNKIGGDLPKG
RETKENYGKTLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEEPPRWTKKPQSAVYST
GSNGILLCEAEGEPQPTIKWRVNGSPVDNHPFAGDVVFPREISFTNLQPNHTAVYQCEAS
NVHGTILANANIDVVDVRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVEEVK
PLEGRRYHIYENGTLQINRTTEEDAGSYSCWVENAIGKTAVTANLDIRNATKLRVSPKNP
RIPKSHMLELHCESKCDSHLKHSLKLSWSKDGEAFEINGTEDGRIIIDGANLTISNVTLE
DQGIYCCSAHTALDSAADITQVTVLDVPDPPENLHLSERQNRSVRLTWEAGADHNSDISE
YIVEFEGNKEEPGRWDELTRVQGKKTTVILPLAPFVRYQFRVIAVNEVGRSQPSQPSDHH
ETPPAAPDRNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYRVTWKPQGAPVEWEEET
VTNHTLRVMTPAVYAPYDVKVQAINQLGSGPDPQSVTLYSGEDYPDTAPVIHGVDVINST
LVKVTWSTVPKDRVHGRLKGYQINWWKTKSLLDGRTHPKEVNILRFSGQRNSGMVPSLDA
FSEFHLTVLAYNSKGAGPESEPYIFQTPEGVPEQPTFLKVIKVDKDTATLSWGLPKKLNG
NLTGYLLQYQIINDTYEIGELNDINITTPSKPSWHLSNLNATTKYKFYLRACTSQGCGKP
ITEESSTLGEGSKGIGKISEGVNLTQKTHPIEVFEPGAEHIVRLMTKNWGDNDSIFQDVI
ETRGREYAGLYDDISTQGWFIGLMCAIALLTLLLLTVCFVKRNRGGKYSVKEKEDLHPDP
EIQSVKDETFGEYSDSDEKPLKGSLRSLNRDMQPTESADSLVEYGEGDHGLFSEDGSFIG
AYAGSKEKGSVESNGSSTATFPLRA
Download sequence
Identical sequences G3R020
ENSGGOP00000008495 ENSGGOP00000018361 XP_004033553.1.27298 XP_018880178.1.27298 XP_018880179.1.27298 XP_018880180.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]