SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018481 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018481
Domain Number 1 Region: 60-343
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.02e-81
Family Regulator of chromosome condensation RCC1 0.02
Further Details:      
 
Domain Number 2 Region: 382-491
Classification Level Classification E-value
Superfamily POZ domain 6.8e-23
Family BTB/POZ domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018481   Gene: ENSGGOG00000004291   Transcript: ENSGGOT00000033078
Sequence length 556
Comment pep:known_by_projection chromosome:gorGor3.1:13:30676183:30720264:-1 gene:ENSGGOG00000004291 transcript:ENSGGOT00000033078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALPRDLELSNPREKLTKPVQATLSSLKMLDVGKWPIFSLCSEEELQLIRQACVFGSAG
NEVLYTTVNDEIFVLGTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYGSGPHIVLAT
TEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFA
WGYNNSGQVGSGSTVNQPIPRRVTGCLQNKVVVTIACGQMCCMAVVDTGEVYVWGYNGNG
QLGLGNSGNQPTPCRVAALQGIRVQRVACGYAHTLVLTDEGQVYAWGANSYGQLGTGNKS
NQSYPTPVTVEKDRIIEIAACHSTHTSAAKTQGGHVYMWGQCRGQSVILPHLTHFSCTDD
VFACFATPAVTWRLLSVEPDDHLTVAESLKREFDNPDTADLKFLVDGKYIYAHKVLLKIR
CEHFRSSLEDNEDDIVEMSEFSYPVYRAFLEYLYTDSISLSPEEAVGLLDLATFYRENRL
KKLCQQTIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTVVTQTSGFAEMDHDL
LKNFISKASRVGAFKN
Download sequence
Identical sequences A0A2I3S6F1 B4DWG0 G3QXR3
ENSP00000389910 ENSP00000389910 ENSGGOP00000018481 NP_001273759.1.87134 NP_001273759.1.92137 XP_011533196.1.92137 XP_016781185.1.37143 XP_016781186.1.37143 XP_016875860.1.92137 XP_016875861.1.92137 ENSGGOP00000018481 ENSP00000389910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]