SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018503 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018503
Domain Number 1 Region: 463-661
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.28e-68
Family Hemopexin-like domain 0.00000000185
Further Details:      
 
Domain Number 2 Region: 89-219,392-447
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.82e-38
Family Matrix metalloproteases, catalytic domain 0.000000305
Further Details:      
 
Domain Number 3 Region: 338-394
Classification Level Classification E-value
Superfamily Kringle-like 2.06e-21
Family Fibronectin type II module 0.0000635
Further Details:      
 
Domain Number 4 Region: 278-335
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-21
Family Fibronectin type II module 0.0000526
Further Details:      
 
Domain Number 5 Region: 222-277
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-20
Family Fibronectin type II module 0.0000528
Further Details:      
 
Domain Number 6 Region: 43-108
Classification Level Classification E-value
Superfamily PGBD-like 3.45e-19
Family MMP N-terminal domain 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018503   Gene: ENSGGOG00000021966   Transcript: ENSGGOT00000027348
Sequence length 661
Comment pep:known_by_projection chromosome:gorGor3.1:16:45296762:45324427:1 gene:ENSGGOG00000021966 transcript:ENSGGOT00000027348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYG
CPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKW
DKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHG
DGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLF
NGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQG
TSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNK
YESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGA
LMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIA
QIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNE
YWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMD
PGFPKLIADAWNAIPDNLDAVVDLQGSGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLG
C
Download sequence
Identical sequences ENSGGOP00000018503 ENSGGOP00000018503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]