SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018565 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018565
Domain Number 1 Region: 682-743
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000001
Family VWC domain 0.0043
Further Details:      
 
Domain Number 2 Region: 761-830
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000418
Family VWC domain 0.06
Further Details:      
 
Domain Number 3 Region: 25-106
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000523
Family VWC domain 0.02
Further Details:      
 
Domain Number 4 Region: 849-912
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000209
Family VWC domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018565   Gene: ENSGGOG00000000110   Transcript: ENSGGOT00000022673
Sequence length 934
Comment pep:known_by_projection chromosome:gorGor3.1:3:185748288:185757220:1 gene:ENSGGOG00000000110 transcript:ENSGGOT00000022673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPGTRGQPPGRHTARAGQRPPAKPVPAGCSFGGKVYALDETWHPDLGEPFGVMRCVLCA
CEAPQWGRRTRGPGRVSCKNIKPECPTPACGQPRQLPGHCCQTCPQERSSSERQPSGLSF
EYPRDPEHRSYSDRGEPGAEERARGDGHTDFVALLTGPRSQAVARARVSLLRSSLRFSIS
YRRLDRPTRVRFSDSNGSVLFEHPAAPTQDGLVCGVWRAVPRLSLRLLRAEQLHVALVTL
THPSGEVWGPLIRHRALAAETFSAILTLEGPPQQGVGGITLLTLSDTEDSLHFLLLFRGL
LEPRSGGLTQVPLRLQILHQGQLLRELQANVSAQEPGFAEVLPNLTVQEMDWLVLGELQM
ALEWAGRPGLRISGHIAARKSCDVLQSVLCGADALIPVQTGAAGSASLTLLGNGSLIYQV
QVVGTSSEVVAMTLETKPQRRDQRTVLCHMAGLQPGGHMAVGICPGLGARGAHMLLQNEL
FLNVGTKDFPDGELRGHVAALPYCGHSARHDTLPVPLAGALVLPPVKSQAAGHAWLSLDT
HCHLHYEVLLAGLGGSEQGTVTAHLLGPPGTPGPRRLLKGFYGSEAQGVVKDLEPELLRH
LAKGMASLLITTKGSPRGELRGQVHIANQCEVGGLRLEAAGAEGVRALGVPDTAAGAPPV
VPGLPALAPAKPGGPGRPRDPNTCFFEGQQRPHGARWAPNYDPLCSLCTCQRRTVICDPV
VCPPPSCPHPVQAPDQCCPVCPEKQDVRDLPGLPRSRDPGEGCYFDGDRSWRAAGTRWHP
VVPPFGLIKCAVCTCKGGTGEVHCEKVQCPRLACAQPVRVNPTDCCKQCPVGSGAHPQLG
DPMQADGPRGCRFAGQWFPESQSWHPSVPPFGEMSCITCRCGAGVPHCERDDCSLPLSCG
SGKESRCCSRCTAHRRPAPETRTDPELEKEAEGS
Download sequence
Identical sequences ENSGGOP00000018565 ENSGGOP00000018565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]