SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018620 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018620
Domain Number 1 Region: 3-233
Classification Level Classification E-value
Superfamily 14-3-3 protein 1.31e-107
Family 14-3-3 protein 0.000000000824
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018620   Gene: ENSGGOG00000022133   Transcript: ENSGGOT00000030733
Sequence length 247
Comment pep:known_by_projection chromosome:gorGor3.1:8:100083255:100118501:-1 gene:ENSGGOG00000022133 transcript:ENSGGOT00000030733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSS
WRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFY
LKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAE
AGEGGEN
Download sequence
Identical sequences W5QBD7
ENSOARP00000020034 ENSGGOP00000018620 ENSGGOP00000018620 9615.ENSCAFP00000000820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]