SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018737 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018737
Domain Number 1 Region: 12-125
Classification Level Classification E-value
Superfamily POZ domain 1.92e-26
Family BTB/POZ domain 0.00062
Further Details:      
 
Domain Number 2 Region: 277-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000396
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 320-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000871
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018737   Gene: ENSGGOG00000024397   Transcript: ENSGGOT00000026869
Sequence length 396
Comment pep:known_by_projection chromosome:gorGor3.1:18:5299839:5301185:-1 gene:ENSGGOG00000024397 transcript:ENSGGOT00000026869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTYF
KKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLD
KLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEGT
PPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALTF
NDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTA
DRPFVCEMCTKGFTTQAHLKEHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHS
ERKQVTPSAIQSETEQLQAAAMAAEAEQQLETIACS
Download sequence
Identical sequences ENSGGOP00000018737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]