SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018742 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018742
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily POZ domain 3.53e-30
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 333-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000209
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018742   Gene: ENSGGOG00000026784   Transcript: ENSGGOT00000024040
Sequence length 476
Comment pep:novel chromosome:gorGor3.1:1:33561384:33578112:1 gene:ENSGGOG00000026784 transcript:ENSGGOT00000024040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMQSYYAKLLGELNEQRKRDFFCDCSIIVEGRIFKAHRNILFANSGYFRALLIHYIQDS
GRHSTASLDIVTSDAFSIILDFLYSGKLDLCGENVIEVMSAASYLQMNDVVNFCKTYIRS
SLDICRKMEKEAAAHQVDSESPSSGREGTSCGTKSLVSSPAEGEKSVDCLRESPCGDCGD
CHPLELVVRDSLGGGSADSDLSTPPKRIEPKVEFDADEVEVDVGEQLQQYAAPLNLAHVE
EALPSGQVVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFPGSLEGRPEGAGVAMSSMM
DVQADWYGEDSGDVLVVPIKLHKCPFCPYTAKQKGILKRHIRSHTGERPYPCETCGKRFT
RQEHLRSHALSVHRSNRPIICKGCRRTFTSHLSQGLRRFGLCDSCTCVTDTPDDDDDLMP
INLSLVEASSESQEKSDTDNDWPIYVESGEENDPAGDDSDDKPQIQPNLSDRETLT
Download sequence
Identical sequences ENSGGOP00000018742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]