SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018760 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018760
Domain Number 1 Region: 809-889
Classification Level Classification E-value
Superfamily DEATH domain 1.77e-19
Family DEATH domain, DD 0.00015
Further Details:      
 
Domain Number 2 Region: 242-292
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000876
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 152-243
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000236
Family I set domains 0.025
Further Details:      
 
Domain Number 4 Region: 296-350
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000706
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Domain Number 5 Region: 45-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000101
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018760   Gene: ENSGGOG00000002104   Transcript: ENSGGOT00000030459
Sequence length 899
Comment pep:known_by_projection chromosome:gorGor3.1:5:161443104:161461383:1 gene:ENSGGOG00000002104 transcript:ENSGGOT00000030459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLLSRCLYPAQSGPWLTFPLCPAAGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNK
PVLLVCKAVPATQIFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGL
EEYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPA
EVEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIV
YVNGGWSTWTEWSVCSASCGRGWQKRSRSCTNPAPLNGGAFCEGQNVQKTACATLCPVDG
SWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECQGADLDTRNCTSDLCVHTASGPEDV
ALYVGLIAVAVCLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHL
LTIQPDLSTTTTTYQGSLCPRQDGPSPKFQLTNGHLLSPLGGGRHTLHHSSPTSEAEEFV
SRLSTQNYFRSLPRGTSNMTYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLH
KPEDVRLPLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSCEGS
WEDVLHLGEEAPSHLYYCQLEASACYVFTEQLGRFALVGEALSVAATKRLKLLLFAPVAC
TSLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSL
WKSKLLVSYQEIPFYHIWNGTQQYLHCTFTLERVSPSTSDLACKLWVWQVEGDGQSFSIN
FNITKDTRFAELLALESEGGVPALVGPSAFKIPFLIRQKIISSLDPPCSRGADWRTLAQK
LHLDSHLSFFASKPSPTAMILNLWEARHFPSGNLSQLAAAVAGLGQPDAGLFTVSEAEC
Download sequence
Identical sequences ENSGGOP00000002072 ENSGGOP00000018760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]