SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018770 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018770
Domain Number 1 Region: 41-145
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000954
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 
Domain Number 2 Region: 114-221
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000528
Family C1 set domains (antibody constant domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018770   Gene: ENSGGOG00000012761   Transcript: ENSGGOT00000029388
Sequence length 278
Comment pep:known_by_projection chromosome:gorGor3.1:3:111623962:111640768:1 gene:ENSGGOG00000012761 transcript:ENSGGOT00000029388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLVIRMPFCHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEAL
IVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYM
CLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIE
NSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLL
LSIVSLVILLVLISILLYWKRHRNQDRGELSQGVQKMT
Download sequence
Identical sequences NYSGRC-IgSF-OX2G_HUMAN XP_008977042.1.60992 XP_009236801.1.23681 XP_016797127.1.37143 ENSGGOP00000018770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]