SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018801 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018801
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.06e-107
Family Inorganic pyrophosphatase 0.0000000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018801   Gene: ENSGGOG00000002175   Transcript: ENSGGOT00000031806
Sequence length 303
Comment pep:known_by_projection chromosome:gorGor3.1:4:114716052:114807889:-1 gene:ENSGGOG00000002175 transcript:ENSGGOT00000031806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEENGIPMKKARNDEYENL
FNMIVEIPRWTNAKMEIATKEPMNPIKQYVKDGKLRYVANIFPYKGYIWNYGTLPQTWED
PHEKDKSTNCFGDNDPIDVCEIGSKILSCGEVIHVKILGILALIDEGETDWKLIAINVND
PEASKFHDIDDVKKFKPGYLEATLNWFRLYKVPDGKPENQFAFNGEFKNKAFALEVIKST
HQCWKALLMKKCNGGAINCTNVQISDSPFRCTQEEARSLVESTLFSPSYQMLNESKVWSL
QGQ
Download sequence
Identical sequences ENSGGOP00000018801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]