SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018850 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018850
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Plus3-like 3.79e-23
Family Plus3 0.00000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018850   Gene: ENSGGOG00000013514   Transcript: ENSGGOT00000032159
Sequence length 297
Comment pep:known_by_projection chromosome:gorGor3.1:15:19983542:19989551:1 gene:ENSGGOG00000013514 transcript:ENSGGOT00000032159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFS
AGMQLPTLDEINKKELSIKEALNYKFNDQDIEEIVKEKERFRKAPPNYAMKKTQLLKEKA
MAEDLGDQDKAKQIQDQLNELEERAEALDRQRTKNISAIRYLFFLNFCFLVVSPISTLIA
ESHNMKNQQMDPFTRRQCKPTIVSNSRDPAVQAAILAQLNAKYGSGVLPDAPKEMSKGQG
KDKDLNSKSASDLSEDLFKVHDFDVKIDLQVPSSGQDRLRPSPPRLRQPRMGLQGDL
Download sequence
Identical sequences ENSGGOP00000018850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]