SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018874 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018874
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily DEATH domain 3.18e-26
Family Pyrin domain, PYD 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018874   Gene: ENSGGOG00000022259   Transcript: ENSGGOT00000025239
Sequence length 92
Comment pep:novel chromosome:gorGor3.1:15:44614844:44615119:1 gene:ENSGGOG00000022259 transcript:ENSGGOT00000025239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFN
GEEKAWAMAVWIFAAINRRDLYEKAKRDEPKW
Download sequence
Identical sequences Q68U67
ENSGGOP00000018874 000144490|e3qf2A1|110.1.1.5|A:1-92 cath|current|3qf2A00/5-94 ENSGGOP00000018874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]