SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018992 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018992
Domain Number 1 Region: 259-437
Classification Level Classification E-value
Superfamily ITPase-like 6.54e-31
Family YjjX-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018992   Gene: ENSGGOG00000010195   Transcript: ENSGGOT00000032193
Sequence length 445
Comment pep:known_by_projection chromosome:gorGor3.1:5:110814584:110843523:1 gene:ENSGGOG00000010195 transcript:ENSGGOT00000032193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEESGIETTPPGTPPPNPAGLAATAMSSTPVPLAATSSFSSPNVSSMESFPPLAYSTPQ
PPLPPVRPSAPLPFVPPPAVPSVPPLVTSMPPPVSPSTAAAFSNPPVSHFPPSTSAPNTL
LPAPPSGPPISGFSVGSTYDITRGHAGRAPQTPLMPSFSAPSGTGLLPTPITQQASLTSL
AQGTGTTSAITFPEEQEDPRFNRGQDEASAGGIWGFIKGVAGNPMVKSVLDKTKHSVESM
ITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVVGEAGQSNIAPQPV
GYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVHGIHL
ETFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLNVSRTDWHMAFTGMS
RRQMIYSAARAIAGMYKQRLPPRTV
Download sequence
Identical sequences A0A2I2Z4B8
XP_004042482.1.27298 ENSGGOP00000018992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]