SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019047 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019047
Domain Number 1 Region: 33-132
Classification Level Classification E-value
Superfamily Immunoglobulin 2.82e-21
Family V set domains (antibody variable domain-like) 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019047   Gene: ENSGGOG00000023009   Transcript: ENSGGOT00000031014
Sequence length 215
Comment pep:known_by_projection chromosome:gorGor3.1:11:116179826:116190690:-1 gene:ENSGGOG00000023009 transcript:ENSGGOT00000031014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALT
VTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGT
YTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRK
KRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD
Download sequence
Identical sequences A0A024R3K1 G3RTC2 O60487
NYSGRC-IgSF-MPZL2_HUMAN ENSGGOP00000019047 ENSP00000278937 ENSP00000408362 9606.ENSP00000278937 ENSP00000278937 ENSP00000408362 gi|21536337|ref|NP_658911.1| gi|5032247|ref|NP_005788.1| ENSGGOP00000019047 ENSP00000278937 NP_005788.1.87134 NP_005788.1.92137 NP_658911.1.87134 NP_658911.1.92137 XP_003820101.1.60992 XP_004052261.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]