SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019061 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019061
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily Immunoglobulin 2.54e-26
Family C1 set domains (antibody constant domain-like) 0.0000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019061   Gene: ENSGGOG00000028372   Transcript: ENSGGOT00000031568
Sequence length 179
Comment pep:novel chromosome:gorGor3.1:7:141283001:141284452:1 gene:ENSGGOG00000028372 transcript:ENSGGOT00000031568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQ
PLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIV
SAEVWGRAGEWGLSTVSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDFRQ
Download sequence
Identical sequences ENSGGOP00000019061 ENSGGOP00000019061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]