SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019165 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019165
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily POZ domain 9.42e-29
Family BTB/POZ domain 0.00084
Further Details:      
 
Domain Number 2 Region: 337-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 441-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-17
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 4 Region: 302-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 395-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000081
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019165
Domain Number - Region: 160-255
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.0811
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019165   Gene: ENSGGOG00000022638   Transcript: ENSGGOT00000023785
Sequence length 586
Comment pep:known_by_projection chromosome:gorGor3.1:3:170718513:170733011:1 gene:ENSGGOG00000022638 transcript:ENSGGOT00000023785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYSHHCEHLLERLNKQREAGFLCDCTIVIGEFQFKAHRNVLASFSEYFGAIYRSTSENN
VFLDQSQVKADGFQKLLEFIYTGTLNLDSWNVKEIHQAADYLKVEEVVTKCKIKMEDFAF
IANPSSTEISSITGNIELNQQTCLLTLRDYNNREKSEVSTDLIQANPKQGALAKKSSQTK
KKKKAFNSPKTGQNKTVQYPSDILENASVELFLDANKLPTPVVEQVAQINNSELELTSVV
ENTFPAQDIVHTVTVKRKRGKSQPNCALKEHSMSNIASVKSPYEAENSREELDQRYSKAK
PMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGEKPYKCE
LCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHASHSRKHTGSSPIYII
ITNIHLLGSLKVPLKYNIDFHLGEKPYICGICGKSFISSGELNKHFRSHTGERPFICELC
GNSYTDIKNLKKHKTKVHSGADKTLDSSAEDHTLSEQDSIQKSPLSETMDVKPSDMTLPL
ALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSEPQLIFLQQLY
Download sequence
Identical sequences ENSGGOP00000019165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]