SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019246 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019246
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily POZ domain 6.28e-25
Family Tetramerization domain of potassium channels 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019246   Gene: ENSGGOG00000015627   Transcript: ENSGGOT00000033492
Sequence length 325
Comment pep:known_by_projection chromosome:gorGor3.1:16:30667075:30687132:-1 gene:ENSGGOG00000015627 transcript:ENSGGOT00000033492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEGRSCRVAASLEAPKLSGLEPGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDT
MLKAMFSGRVEVLTDAGGWVLIDRSGRHFGTILNYLRDGSVPLPESTRELGELLGEARYY
LVQGLIEDCQLALQQKRETLSPLCLIPTVTSPREEQQLLASTSKPVVKLLHNRSNNKYSY
TSTSDDNLLKNIELFDKLALRFHGRLLFLKDVLGDEICCWSFYGQGRKIAEVCCTSIVYA
TEKKQTKVEFPEARIFEETLNILIYETPRGPDPALLEATGGAAGAGGAGRGEDEENREHR
VRRIHVRRHITHDERPHGQQIVFKD
Download sequence
Identical sequences ENSGGOP00000019246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]