SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019437 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019437
Domain Number 1 Region: 29-512
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-184
Family ALDH-like 0.000000000000931
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019437   Gene: ENSGGOG00000013340   Transcript: ENSGGOT00000013385
Sequence length 517
Comment pep:known_by_projection chromosome:gorGor3.1:9:39236524:39242226:1 gene:ENSGGOG00000013340 transcript:ENSGGOT00000013385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRFLVPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPT
TGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRQMDASERGRLLNRLADLVERDRVYLA
SLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPVDGQHFCFTRHEPVGVCG
QIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITG
YGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADM
EHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGP
QVDKEQFEQVLGYIQLGQKEGTKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
VQPLFKFKKIEEVIERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHT
PFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
Download sequence
Identical sequences G3RUF8
ENSGGOP00000019437 XP_004048099.1.27298 XP_004048101.1.27298 ENSGGOP00000019437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]