SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019478 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019478
Domain Number 1 Region: 371-449
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000488
Family I set domains 0.038
Further Details:      
 
Domain Number 2 Region: 35-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000104
Family I set domains 0.075
Further Details:      
 
Domain Number 3 Region: 276-359
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000225
Family I set domains 0.054
Further Details:      
 
Domain Number 4 Region: 460-537
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000393
Family I set domains 0.056
Further Details:      
 
Domain Number 5 Region: 166-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000342
Family C2 set domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019478   Gene: ENSGGOG00000001705   Transcript: ENSGGOT00000034581
Sequence length 588
Comment pep:known_by_projection chromosome:gorGor3.1:19:42018011:42029111:1 gene:ENSGGOG00000001705 transcript:ENSGGOT00000034581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPDAPAQARGAPRLLLLAVVLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHD
HYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDE
RDYVCVVRAGAAGTAEATARLSVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPA
PKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAH
YSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPE
YTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAY
LDPLELSERKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNG
TYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPD
PKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTV
SPQTSQAGVAVMAVAVSVGLLLLVVAVFYCMRRKGGPCCRQRREKGAP
Download sequence
Identical sequences G3RRI3
ENSGGOP00000018407 ENSGGOP00000019478 XP_004060983.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]