SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019480 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019480
Domain Number 1 Region: 11-138
Classification Level Classification E-value
Superfamily POZ domain 1.84e-26
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 442-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 403-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000496
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 331-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000757
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019480   Gene: ENSGGOG00000027584   Transcript: ENSGGOT00000029081
Sequence length 631
Comment pep:known_by_projection chromosome:gorGor3.1:17:2028875:2031038:1 gene:ENSGGOG00000027584 transcript:ENSGGOT00000029081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECAGQTMLDTMEAPGHSRQLLLQLNNQRTKGFLCDVIIVVQNALFRAHKNVLAASSAYLK
SLVVHDNLLNLDHDMVSPAVFRLVLDFIYTGRLADGAEAAAAAAVAPGAEPSLGAVLAAA
SYLQIPDLVALCKKRLKRHGKYCHLRGGGGGGGGYAPYGRPGRGLRAATPVIQACYPSPV
GPPPPPAAEPPSGPEAAVNTHCAELYASGPGPAAALCASERRCSPLCGLDLSKKSPPGSA
APERSLAERELPPRPDSPRDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEE
TGSSEDPSPPGGHLEGYPCPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLNAHVEAHVEE
EEALYGRAEAAEVAAGAAGLGPPFGGGGDKVAGAPGGLGELLRPYRCASCDKSYKDPATL
RQHEKTHWLTRPYPCTICGKKFTQRGTMTRHMRSHLGLKPFACDACGMRFTRQYRLTEHM
RIHSGEKPYECQVCGGKFAQQRNLISHMKMHAVGGAAGAAGALAGLGGLPGVPGPDGKGK
LDFPEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELG
LSPDKAAEVLSQGAHLAAGPDGRTIDRFSPT
Download sequence
Identical sequences G3RUK1
ENSGGOP00000023577 ENSGGOP00000019480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]