SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019552 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019552
Domain Number 1 Region: 198-295
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 102-202
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000452
Family C1 set domains (antibody constant domain-like) 0.032
Further Details:      
 
Domain Number 3 Region: 9-104
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000408
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019552   Gene: ENSGGOG00000010219   Transcript: ENSGGOT00000032820
Sequence length 413
Comment pep:known_by_projection chromosome:gorGor3.1:11:113032952:113101836:-1 gene:ENSGGOG00000010219 transcript:ENSGGOT00000032820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLN
FSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEE
IEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQ
VEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWV
RVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPTK
DLSTMQTSNTVNTVFPELKNTTATTEPAVHDSRAGEEGSIRAVDHAVIGGVVAVVVFAML
CLLIILGRYFARHKGTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI
Download sequence
Identical sequences ENSGGOP00000019552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]