SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019603 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019603
Domain Number 1 Region: 37-76,220-283
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000725
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 97-192
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000364
Family C1 set domains (antibody constant domain-like) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019603   Gene: ENSGGOG00000022856   Transcript: ENSGGOT00000030684
Sequence length 460
Comment pep:known_by_projection chromosome:gorGor3.1:1:140165508:140181731:-1 gene:ENSGGOG00000022856 transcript:ENSGGOT00000030684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLSLGAEMWGLEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKLPCFYRGDSGE
QVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRPPLPSLNPGPALEEGQGLTLAAS
CTAEGSPAPNVTWDTDVKGTTSSRSFKHSRSAAVTSEFHLVPSRSMNGQPLTCVVSHPGL
LQDQRITHILHVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQPPPSYNWTRLDGPLP
SGVRVDGDTLGFPPLTTEHSGIYVCHVSNEFSSTDSQVTVDVLDPQEDSGKQVDLVSASV
VVVGVIAALLFCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRS
QPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEE
EEDQDEGIKQAMNHFVQENGTLRAKPTGNGIYINGRGHLV
Download sequence
Identical sequences ENSGGOP00000019603 ENSGGOP00000019603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]