SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019614 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019614
Domain Number 1 Region: 387-501
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.14e-18
Family Mannose 6-phosphate receptor domain 0.0072
Further Details:      
 
Domain Number 2 Region: 211-260
Classification Level Classification E-value
Superfamily EF-hand 0.0000137
Family Calmodulin-like 0.088
Further Details:      
 
Domain Number 3 Region: 71-111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000406
Family LDL receptor-like module 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019614
Domain Number - Region: 34-69
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000196
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 340-386
Classification Level Classification E-value
Superfamily Tropomyosin 0.0019
Family Tropomyosin 0.012
Further Details:      
 
Domain Number - Region: 130-224
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0209
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019614   Gene: ENSGGOG00000008626   Transcript: ENSGGOT00000031438
Sequence length 516
Comment pep:known_by_projection chromosome:gorGor3.1:19:11653143:11668700:1 gene:ENSGGOG00000008626 transcript:ENSGGOT00000031438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGEMLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCD
CKDGSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTCK
EKGRKERESLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLIELQAGKKSLEDQVEMLR
TVKEEAEKPEREAKEQHQKLWEEQLAAAKAQQEQELAADAFKELDDDMDGTVSVTELQTH
LELDTDGDGALSEAEAQALLSGDTQIDATSFYDRVWAAIRDKYRSEALPTDLPAPSAPDL
TEPKEEQPPVPSSPNSEVQGEQPEEAPPPLSPPQPASPAEEDRMPPYDEQTQAFIDAAQE
ARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQCYELTTNEYVYRLCPFKL
VSQKPKLGGSPTSLGTWGSWVGPDHDKFSAMKYEQGTGCWQGPNRSTTVRLLCGKETMVT
STTEPSRCEYLMELMTPAACPEPPPEAPTEDDHDEL
Download sequence
Identical sequences ENSGGOP00000019614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]