SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019636 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019636
Domain Number 1 Region: 157-305
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.75e-29
Family Toll/Interleukin receptor TIR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 5-100
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000952
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019636   Gene: ENSGGOG00000026709   Transcript: ENSGGOT00000030371
Sequence length 497
Comment pep:known_by_projection chromosome:gorGor3.1:11:317939:320926:-1 gene:ENSGGOG00000026709 transcript:ENSGGOT00000030371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCDRAPDFLSPSEDQVLRPALGSSVALNCTTWVVSGPHCSLPSVQWLKDGLPLGNGGHYS
LYEYSWVKANLSEVLVSSVLGVNVTSAEVYGAFTCSIQNISFSSFTLQRAGPTSHVAAVL
ASLLVLLALLLAALLYVKCRLNVLLWYQDAYGEVEMNDGKLYDAYVSYSDCPEDRKFVNF
ILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSHSFR
EGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHRHLVTLLLWRPGSVTPSSDFWKEM
QLALPRKVRYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDPDPEGDLGMPAQPH
SPTGEAQHRAEWGQAQGPGGAPGVESWHRGPLHGLCPGGARPSVCLGTSWASQAITAGGE
QWQPLAVGLGQGCGWPPQASRSPHPRCPGACLWRAISSTAHQWGLAGREPEQRSGRLGSR
LAKLQCPHRLLLPGVQG
Download sequence
Identical sequences ENSGGOP00000019636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]