SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019681 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019681
Domain Number 1 Region: 28-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000223
Family V set domains (antibody variable domain-like) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019681   Gene: ENSGGOG00000004376   Transcript: ENSGGOT00000032936
Sequence length 319
Comment pep:known_by_projection chromosome:gorGor3.1:10:60798851:60892946:-1 gene:ENSGGOG00000004376 transcript:ENSGGOT00000032936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGDLGPSSSSLLPFFSAEVCAALNVTVSPGPVVDYLEGENATLLCHVSQKRRKDSLLAVR
WFFAHSSDSQEALMVKMTKLRVVQYYGNFSRSAKRRRLRLLEEQRGALYRLSVLTLQPSD
QGHYVCRVQEISRHRNKWTAWSNGSSATEMRVISLKASEESSFEKTKETWAFFEDLYVYA
VLVCCVGILSILLFMLVIVWQSVFNKRKSRVRHYLVKCPQNSSGETVTSVTSLAPLQPKK
GKRQKEKPDIPPAVPAKAPIAPTFHKPKLLKPQRKVTLPKIAEENLTYAELELIKPHRAA
KGAPTSTVYAQILFEENKL
Download sequence
Identical sequences ENSGGOP00000019681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]