SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019789 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019789
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily Immunoglobulin 6.41e-34
Family V set domains (antibody variable domain-like) 0.0000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019789   Gene: ENSGGOG00000022778   Transcript: ENSGGOT00000029495
Sequence length 111
Comment pep:novel chromosome:gorGor3.1:22:6456415:6460603:1 gene:ENSGGOG00000022778 transcript:ENSGGOT00000029495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSALTQPHSVPGSPGQSVTISCTGTSSDVGHYNYVSWCQQHPGQAPVLVIYKDSERPSGI
PERFSGSSSGTTVTLTISGAQVEDEADYYCYSAADNNLTVTQADGEMRHKP
Download sequence
Identical sequences ENSGGOP00000019789 ENSGGOP00000019789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]