SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019810 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019810
Domain Number 1 Region: 230-524
Classification Level Classification E-value
Superfamily Kelch motif 4.58e-77
Family Kelch motif 0.0000892
Further Details:      
 
Domain Number 2 Region: 27-87
Classification Level Classification E-value
Superfamily POZ domain 0.0000000157
Family BTB/POZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019810   Gene: ENSGGOG00000025011   Transcript: ENSGGOT00000028153
Sequence length 536
Comment pep:known_by_projection chromosome:gorGor3.1:18:29895450:29990968:-1 gene:ENSGGOG00000025011 transcript:ENSGGOT00000028153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQPRPPQEEPGTPSSSPDDKLLTSPRAINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTV
EEVLSVSKILHIPQVTKLCVQFLNDQISVQNYKQVCKIAALHGLEETKKLANKYLVEDVL
LLNFEEMRALLDSLPPPVESELALFQMSVLWLEHDRETRMQYAPDLMKRLRFALIPAPEL
VERVQSVDFMRTDPVCQKLLLDAAILSYHKFSFLEHCRISSFSAIRSNKKMLLLVGGLPP
GPDRLPSNLVQYYDDEKKTWKILTIMPYNSAHHCVVEVENFLFVLGGEDQWNPNGKHSTN
FVSRYDPRFNSWIQLPPMQERRASFYACRLDKHLYVIGGRNETGYLSSVECYNLETNEWR
YVSSLPQPLAAHAGAVHNGKIYISGGVHNGEYVPWLYCYDPVMDVWARKQDMNTKRAIHT
LAVTNDRLYAIGGNHLKGFSHLDVMLVECYDPKGDQWNILQTPILEGRSGPGCAVLDDSI
YLVGGYSWSMGAYKSSTICYCPEKGTWTELEGDVAEPLAGPACVTVILPSCVPYNK
Download sequence
Identical sequences ENSGGOP00000019810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]