SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019811 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019811
Domain Number 1 Region: 272-556
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.92e-75
Family WD40-repeat 0.0000997
Further Details:      
 
Domain Number 2 Region: 201-301
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000000322
Family Quinoprotein alcohol dehydrogenase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019811   Gene: ENSGGOG00000007537   Transcript: ENSGGOT00000031813
Sequence length 561
Comment pep:known_by_projection chromosome:gorGor3.1:X:9254916:9537459:1 gene:ENSGGOG00000007537 transcript:ENSGGOT00000031813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTELAGASSSCCHRPAGRGAMQSVLHHFQRLRGREGGSHFNTSSPRGEAKMSITSDEVNF
LVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDG
TVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQATTTTSAGVSHQNPSKNREATVN
GEENRAHSVNNHAKPMEIDGEVEIPSSKATVLRGHESEVFICAWNPVSDLLASGSGDSTA
RIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNTNGTLLATGSYDGFARIWT
EDGNLASTLGQHKGPIFALKWNRKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALD
VDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTL
KIWSMKQEVCIHDLQAHNKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDIERGV
CTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNA
RGDKVGASASDGSVCVLDLRK
Download sequence
Identical sequences ENSGGOP00000019811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]