SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019822 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019822
Domain Number 1 Region: 7-127
Classification Level Classification E-value
Superfamily POZ domain 6.02e-27
Family BTB/POZ domain 0.00041
Further Details:      
 
Domain Number 2 Region: 520-580
Classification Level Classification E-value
Superfamily A DNA-binding domain in eukaryotic transcription factors 6.8e-21
Family A DNA-binding domain in eukaryotic transcription factors 0.0013
Further Details:      
 
Domain Number 3 Region: 566-609
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000157
Family Leucine zipper domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019822   Gene: ENSGGOG00000006094   Transcript: ENSGGOT00000032283
Sequence length 736
Comment pep:known_by_projection chromosome:gorGor3.1:21:17574188:17622660:1 gene:ENSGGOG00000006094 transcript:ENSGGOT00000032283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFH
SRIVGQADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEE
SCFQFLKFKFLDSTADQQECPRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQ
TPQCKLRRYQGNAKASPPLQDSASQTYESMCLEKDAALALPSLCPKYRKFQKAFGTDRVR
TGESGVKDIHASVQPNERSENECLGGVPECRDLQVMLKCDESKLAMEPEETKKDPASQCS
TEKSEVTPFPHNSSIDPHGLYSLSLLHTYDQYGDLNFAGMQNTTVLTEKPLSGTDVQEKT
FGESQDLPLKSDLGTREDSSLASSDRSSVEREVAEHLAKGFWSDICSTDTPCQMQLSPAV
AKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFMSTLSTEGCSSNLEIGS
DDYISEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSRND
FQSLLKMHKLTPEQLDCIHDIRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLQSEKESLL
KERDHILSTLGETKQNLTGLCQKVCKEAALSQEQIQILAKYSAADCPLSFLISEKDKSTP
DGELALPSIFSLSDRPPAVLPPCARGNSEPGYARGQESQQMSTATSEQAGPAEQCRQSGG
ISDFCQQMTDKCTTDE
Download sequence
Identical sequences ENSGGOP00000019822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]