SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019824 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019824
Domain Number 1 Region: 72-436
Classification Level Classification E-value
Superfamily L domain-like 1.02e-56
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 555-653
Classification Level Classification E-value
Superfamily Immunoglobulin 6.87e-21
Family I set domains 0.0087
Further Details:      
 
Domain Number 3 Region: 450-559
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-18
Family I set domains 0.02
Further Details:      
 
Domain Number 4 Region: 642-736
Classification Level Classification E-value
Superfamily Immunoglobulin 3.43e-18
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019824   Gene: ENSGGOG00000022639   Transcript: ENSGGOT00000033908
Sequence length 1002
Comment pep:known_by_projection chromosome:gorGor3.1:1:116015757:116071381:1 gene:ENSGGOG00000022639 transcript:ENSGGOT00000033908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAPLGVPEEQLLGCRSRLLSRLLFIAQTALLLLPAAGAGLCPAPCSCRIPLLDCSRRK
LPAPSWRALSGLLPPDTAILDLSHNRLSNWNISLESQTLQEVKMNYNELTEIPYFGEPTS
NITLLSLVHNIIPEINAQALQFYPALESLDLSSNIISEIKTSSFPRMQLKYLNLSNNRIT
TLEAGCFDNLSSSLLVVKLNRNRISMIPPKIFKLPHLQFLELKRNRIKIVEGLTFQGLDS
LRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTRVNKGWLYGLRMLQQLYVSQNAIE
RISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSN
LQTLDLRNNEISWAIEDASEAFAGLTSLTKLILNTSSLLCDCHLKWLLQRLVDNNFQHSV
NVSCAHPEWLAGQSILNVDLKDFVCDDFLKPQIRTHPETIIALRGMNVTLTCTAVSSSDS
PMSTVWRKDSEILYDLDTENFVRYRQQAGEALEYTSILHLFNVNFTDEGKYQCIVTNHFG
SNYSQKAKLTVNEMPSFLKTPVDLTIRTGAMARLECAAEGHPAPQISWQKDGGTDFPAAR
ERRMHVMPEDDVFFIANVKIEDMGIYSCMAQNTAGGLSANASLTVLETPSFIRPLEDKTV
TGETAVLQCIAGGSPAPRLNWTKDDGPLLVTERHFFAAANQLLIIVDAGLEDAGKYTCIM
SNTLGTECGHIYLNVISSPNCDSSQSSIGHEDDGWTTVGIVIIVVVCCVVGTSLIWVIVI
YHMRRKNEDYSITNTEELNLPADIPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYI
HKGTDGGTSTRVICSDCYDNANIYSRTREYCPYTYIAEEDVLDQTLSSLMVQMPKETYLV
HPPQDTTALESLIPSANREPSAFPTNHERISEKKLPSTEMSGETLQRPVWSINRELGLPH
PAFSQQPVHESPQLHQNEGLAGREPDCSASSMSCHRLQDHAF
Download sequence
Identical sequences ENSGGOP00000019824 ENSGGOP00000019824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]