SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019862 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019862
Domain Number 1 Region: 9-127
Classification Level Classification E-value
Superfamily POZ domain 2.35e-22
Family BTB/POZ domain 0.00086
Further Details:      
 
Domain Number 2 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.23e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 464-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 387-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000307
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 328-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000117
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 297-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000607
Family Classic zinc finger, C2H2 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019862   Gene: ENSGGOG00000023248   Transcript: ENSGGOT00000032762
Sequence length 690
Comment pep:known_by_projection chromosome:gorGor3.1:20:23971521:23979402:1 gene:ENSGGOG00000023248 transcript:ENSGGOT00000032762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGAVLLESKSSPFNLLHEMHELRLLGHLCDVTVSVEYQGVRKDFMAHKAVLAATSKFF
KEVFLNEKSVDGTRTNVYLNEVQVADFASFLEFVYTAKVQVEEDRVQRMLEVAEKLKCLD
LSETCFQLKKQMLESVLLELQNFSESQEVEVSSGSQVSAAPAPRASVATDGPHPNGLTDS
LGYPGERASNGMSSDLPPKKSKDKLDKKKEVVKPPYPKIRRASGRLAGRKVFVEIPKKKY
TRRLREQQKTAEGDVGDYRCPQDQSPDRVGTEMEPVSKNEGCQAGAELEELSKKAGNFKC
SICEKAFLYEKSFLKHSKHRHGVATEVVYRCDTCGQTFANRCNLKSHQRHVHSSERHFPC
ELCGKKFKRKKDVKRHVLQVHEGGGERHRCGQCGKGLSSKTALRLHERTHTGDRPYGCTE
CGARFSQPSALKTHMRYAGSRPEGSLRTGRFSKVFMIYYVTVSHVGERPFMCETCGKSFA
SKEYLKHHNRIHTGSKPFKCEVCFRTFAQRNSLYQHIKVHTGERPYCCDQCGKQFTQLNA
LQRHRRIHTGERPFMCNACGRTFTDKSTLRRHTSIHDKNTPWKSFLVIVDGSPKNDDGHK
TEQPDEEYVSSKLSDKLLSFAENGHFHNLAAVQDTVPTMQENSSADTACKADDSMVSQDT
LLATTISELSELTPQTDSMPTQLHSLSNME
Download sequence
Identical sequences ENSGGOP00000019862 ENSGGOP00000019862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]