SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019872 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019872
Domain Number 1 Region: 27-165,208-410
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 2.09e-16
Family Tricorn protease domain 2 0.06
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019872
Domain Number - Region: 789-842
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0972
Family Glyoxalase I (lactoylglutathione lyase) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019872   Gene: ENSGGOG00000004204   Transcript: ENSGGOT00000027576
Sequence length 1343
Comment pep:known_by_projection chromosome:gorGor3.1:9:91210999:91275444:-1 gene:ENSGGOG00000004204 transcript:ENSGGOT00000027576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYLSRGNHFIMRNLKLFRTLEFRDIQGPGNPQCFSLRTEQGTVLIGSEHGLIEVDPVSRE
VKNEVSLVAEGFLPEDGSGHIVGVQDLLDQESVCVATASGDVILCSLSTQQLECVGSVAS
GISVMSWSPDQELVLLATGQQTLIMMTKDFEPILEQQIHQDDFGESKFITVGWGRKETQF
HGSEGRQAAFQMQMHESALPWDDHRPQVTWRGDGQFFAVSVVCPETGARKVRVWNREFAL
QSTSEPVAGLGPALAWKPSGSLIASTQDKPNQQDIVFFEKNGLLHGHFTLPFLKDEVKVN
DLLWNADSSVLAVWLEDLQREESSIPKTCVQLWTVGNYHWYLKQSLSFSTCGKSKIVSLM
WDPVTPYRLHVLCQGWHYLAYDWHWTTDRSVGDNSSDLSNVAVIDGNRVLVTVFRQTVVP
PPMCTYQLLFPHPVNQVTFFAHPQKSNDLAVLDASNQISVYKCGDCPSADPTVKLGAVGG
SGFKVCLRTPHLEKRYKIQFENNENQDVNPLKLGLLTWIEEDVFLAVSHSEFSPRSVIHR
LTAASSEMDEEHGQLNVSSSAVVDGVIISLCCNSKTKSVVLQLADGQIFKYLWESPSLAI
KPWKNSGGFPVRFPYPCTQTELAMIGEEECVLGLTDRCRFFINDIEVASNITSFAVYDEF
LLLTTHSHTCQCFCLRDASFKTLQAGLSSNHVSHGEVLRKVERGSRIVTVVPQDTKLVLQ
MPRGNLEVVHHRALVLAQIRKWLDKLMFKEAFECMRKLRINLNLIYDHNPKVFLENVETF
IKQIDSVNHINLFFTELKEEDVTKTMYPAPVTSSVYLSRDPDGNKLDLVCDAMRAVMESI
NPHKYCLSILTSHVKKTTPELEIVLQKVHELQGNAPSDPDAVSAEEALKYLLLLVDVNEL
YDHSLGTYDFDLVLMVAEKSQKGWRQICEFLGPTFLSPCAYESVLIVRLKKYTYSLTEIQ
KVHSFIHNKDILKKHLRIEFAKVETMRKDHYKTGSLKATYSWLLLPFSLLEMSLLPRGPG
GTADGRLMHKIILCNLHTIKLCVVQSTIFSKGGLVKIGMMLRTRSSPLAREIEAALCLFP
CQDYEEAVLLLLEGAAWEEALRLVYKYNRLDIIETNIKPSILEASPAQKNYMAFLDSQTA
TFSRHKKRLLVVRELKEQAQQAGLDDAVPHGQESDLFSETSSVVSGSEMSGKYSHSNSRI
SARSSKNRRKAERKKHSLKEGSPLEDLALLEALSEVVQNTENLKDEVYHILKVLFLFEFD
EQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPV
LDAELFIPPKINRRTQWKLSLLD
Download sequence
Identical sequences ENSGGOP00000004132 ENSGGOP00000019872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]