SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019885 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000019885
Domain Number - Region: 88-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00362
Family V set domains (antibody variable domain-like) 0.039
Further Details:      
 
Domain Number - Region: 174-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0412
Family C1 set domains (antibody constant domain-like) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019885   Gene: ENSGGOG00000000291   Transcript: ENSGGOT00000025208
Sequence length 338
Comment pep:known_by_projection chromosome:gorGor3.1:1:139678837:139716036:-1 gene:ENSGGOG00000000291 transcript:ENSGGOT00000025208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPKGLLSLIFMLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSI
HIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLM
TLEKNVSVQRFCLQLRLYGPITISDTQKHLLHTHPLTHPCARVHACMRAKGDHVAYSWSE
KAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPW
AVYAGLLGGVIMILIMVVILQLRRRAGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSF
PAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES
Download sequence
Identical sequences ENSGGOP00000000287 ENSGGOP00000019885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]