SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019897 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019897
Domain Number 1 Region: 720-923
Classification Level Classification E-value
Superfamily Fibronectin type III 6.35e-42
Family Fibronectin type III 0.00000151
Further Details:      
 
Domain Number 2 Region: 921-1121
Classification Level Classification E-value
Superfamily Fibronectin type III 1.4e-39
Family Fibronectin type III 0.00098
Further Details:      
 
Domain Number 3 Region: 1216-1395
Classification Level Classification E-value
Superfamily Fibronectin type III 8e-31
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 59-147
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-23
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 516-619
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-20
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 426-526
Classification Level Classification E-value
Superfamily Immunoglobulin 4.19e-20
Family I set domains 0.022
Further Details:      
 
Domain Number 7 Region: 1122-1221
Classification Level Classification E-value
Superfamily Immunoglobulin 3.34e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 8 Region: 241-341
Classification Level Classification E-value
Superfamily Immunoglobulin 9.17e-19
Family I set domains 0.0096
Further Details:      
 
Domain Number 9 Region: 142-229
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000292
Family I set domains 0.028
Further Details:      
 
Domain Number 10 Region: 342-432
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000431
Family I set domains 0.052
Further Details:      
 
Domain Number 11 Region: 621-724
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000409
Family I set domains 0.04
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019897
Domain Number - Region: 3-54
Classification Level Classification E-value
Superfamily Immunoglobulin 0.015
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019897   Gene: ENSGGOG00000006455   Transcript: ENSGGOT00000030490
Sequence length 1866
Comment pep:known_by_projection chromosome:gorGor3.1:11:115346776:115450933:-1 gene:ENSGGOG00000006455 transcript:ENSGGOT00000030490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSPENRFFITYHGGLYISDVQKEDALSTYRCITKHKYSGETRQSNGARLSVTDPAESIPT
ILDGFHSQEVWAGHTVELPCTASGYPIPAIRWLKDGRPLPADSRWTKRITGLTISDLRTE
DSGTYICEVTNTFGSAEATGILMVIDPLHVTLTPKKLKTGIGSTVILSCALTGSPEFTIR
WYRNTELVLPDEAISIRGLSNETLLITSAQKSHSGAYQCFATRKAQTAQDFAIIALEDGT
PRIVSSFSEKVVNPGEQFSLMCAAKGAPPPTVTWALDDEPIMRDGSHRTNQYTMSDGTTI
SHMNVTGPQIRDGGVYRCTARNLVGSAEYQARINVRGPPSIRAMRNITAVAGRDTLINCR
VIGYPYYSIKWYKDALLLPDNHRQVVFENGTLKLTDVQKGMDEGEYLCSVLIQPQLSISQ
SVHVAVKVPPLIQPFEFPPASIGQLLYIPCVVSSGDMPIRITWRKDGQVIISGSGVTIES
KEFMSSLQISSVSLKHNGNYTCIASNAAATVSRERQLIVRVPPRFVVQPNNQDGIYGKAG
VLNCSVDGYPPPKVMWKHAKGSGNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLC
QASNGVGTDISKSMFLTVKIPAMITSHPNTTIAIKGHAKELNCMARGERPIIIRWEKGDT
VIDPDRVMRYAIATKDNGDEVVSTLKLKPADRGDSVFFSCHAINSYGEDRGLIQLTVQEP
PDPPELEIREVKARSMNLRWTQRFDGNSIITGFDIEYKNKSDSWDFKQSTRNISPTINQA
NIVDLHPASVYSIRMYSFNKIGRSEPSKELTISTEEAAPDGPPMDVTLQPVTSQSIQVTW
KAPKKELQNGVIRGYQIGYRENSPGSNGQYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQ
AFNRAGTGPSSSEINATTLEDVPSQPPENVRALSITSDVAVISWSEPPRSTLNGVLKGYR
VIFWSLYVDGEWGEMQNITTTRERVELRGMEKFTNYSVQVLAYTQAGDGVRSSVLYIQTK
EDVPGPPAGIKAVPSSASSVVVSWLPPTKPNGVIRKYTIFCSSPGSGQPAPSEYETSPEQ
LFYRIAHLNRGQQYLLWVAAVTSAGRGNSSEKVTIEPAGKAPAKIISFGGTVTTPWMKDV
RLPCNSVGDPAPAVKWTKDSEDSAIPVSMDGHRLIHTNGTLLLRAVKAEDSGYYTCTATN
TGGFDTIIVNLLVQVPPDQPRLTVSKTSASSITLTWIPGDNGGSSIRGFVLQYSVDNSEE
WKDVFISSSERSFKLDSLKCGTWYKVKLAAKNSVGSGRISEIIEAKTHGREPSFSKDQHL
FTHINSTHARLNLQGWNNGGCPITAIVLEYRPKGTWAWQGLRANSSGEVFLTELREATWY
ELRMRACNSAGCGNETAQFATLDYDGSTIPPIKSAQGEGDDVKKLFTIGCPVILATLGVA
LLFIVRKKRKEKRLKRLRDAKSLAEMLISKNNRSFDTPVKGPPQGPRLHIDIPRVQLLIE
DKEGIKQLGDDKATIPVTDAEFSQAVNPQSFCTGVSLHRPALIQSTGPLIDMSDIRPGTN
PVSRKNVKSAHSTRNRYSSQWTLTKCQASTPARTLTSDWRTVGSQHGVTVTESDSYSASL
SQDTDKGRNSMVSTESASSTYEELARAYEHAKLEEQLQHAKFEITECFISDSSSDQMTTG
TNENADSMTSMSTPSEPGICRFTASPPKPQDADRGKNVAVPIPHRANKSDYCNLPLYAKS
EAFFRKADGREPCPVVPPREASIRNLARTYHTQARHLTLDPASKPLGLPHPGTPAAASTA
TLPQRTLAMPAPPAGTPAPSTEPPRAGGPHTKMGGSRDSLLEMSTSGVGRSQKQGAGAYS
KSYTLV
Download sequence
Identical sequences ENSGGOP00000019897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]