SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019918 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019918
Domain Number 1 Region: 23-131
Classification Level Classification E-value
Superfamily Immunoglobulin 6.84e-37
Family V set domains (antibody variable domain-like) 0.000011
Further Details:      
 
Domain Number 2 Region: 134-231
Classification Level Classification E-value
Superfamily Immunoglobulin 6.09e-30
Family C1 set domains (antibody constant domain-like) 0.00000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019918   Gene: ENSGGOG00000024456   Transcript: ENSGGOT00000029968
Sequence length 237
Comment pep:novel chromosome:gorGor3.1:22:6681528:6697047:1 gene:ENSGGOG00000024456 transcript:ENSGGOT00000029968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWIPLFLGVLAYCTGSVASYELTQPPSVSVSPGQTASITCSGDKLGDEYAYWYQQKPGQ
SPVLVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAHSSLCY
VFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPV
KAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
Download sequence
Identical sequences ENSGGOP00000019918 ENSGGOP00000019918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]